PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast07G229800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 318aa    MW: 34703.8 Da    PI: 5.8112
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast07G229800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.81.5e-072542872154
                         HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         k +yp++e++++L +++gL+ +q+ +WF N+R +
  Brast07G229800.1.p 254 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 287
                         569*****************************87 PP

2ELK28.14.8e-10208229122
                 ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                         ELKh+L+++Y+++L+++++E++
  Brast07G229800.1.p 208 ELKHELKQGYREKLIDIREEIL 229
                         9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.8E-174791IPR005540KNOX1
PfamPF037902.2E-145087IPR005540KNOX1
SMARTSM012563.1E-2597152IPR005541KNOX2
PfamPF037919.1E-17105151IPR005541KNOX2
SMARTSM011880.0058208229IPR005539ELK domain
PROSITE profilePS5121310.092208228IPR005539ELK domain
PROSITE profilePS5007111.596228291IPR001356Homeobox domain
SuperFamilySSF466898.55E-16230295IPR009057Homeodomain-like
SMARTSM003894.9E-10230295IPR001356Homeobox domain
CDDcd000862.65E-11231292No hitNo description
Gene3DG3DSA:1.10.10.603.3E-24235292IPR009057Homeodomain-like
PfamPF059203.7E-18248287IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MAFHYQDHAA LAMDAAAAAS ASAAAGVNPN SSSFGAPGGV GVGVGWEREK AAVEAHPLYE  60
RLLEAHVACL RVATPVDQLP RIDAQIAARP PPAPVPPAAA ASGGEELDLF MTHYVLLLCS  120
FKEQLQQHVR VHAMEAVMAC WELEQTLQSL TGASPGEGTG ATMSDDEDNP IDTESNMFDG  180
NDGSDGMGFG PLMLTEGERS LVERVRQELK HELKQGYREK LIDIREEILR KRRAGKLPGD  240
TASTLKAWWQ AHAKWPYPTE EDKARLVQET GLQLKQINNW FINQRKRNWH SNPTSSSSDK  300
SKRKRSNAGD GNAEQSW*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1284304RKRNWHSNPTSSSSDKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0998780.0FP099878.1 Phyllostachys edulis cDNA clone: bphylf032a14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563314.10.0PREDICTED: homeobox protein knotted-1-like 11 isoform X1
SwissprotQ0E3C31e-175KNOS2_ORYSJ; Homeobox protein knotted-1-like 2
TrEMBLI1GVI20.0I1GVI2_BRADI; Uncharacterized protein
STRINGBRADI1G30730.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-140KNOTTED1-like homeobox gene 3